TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B2MZA8|B2MZA8_CAEEL Protein LAT-2, isoform b OS=Caenorhabditis elegans GN=lat-2 PE=4 SV=1
MDISGQVGRLSGGLASALDVVSTIGCAISIVCLALSVCVFTFFRNLQNVRNSIHRNLCLCLLIAELVFVIGMDRTGNRTG
CGVVAILLHYFFLSSFCWMLLEGYQLYMMLIQVFEPNRTRIFLYYLFCYGTPAVVVAISAGIKWEDYGTDSYCWIDTSTP
TIWAFVAPIIVIIAANIIFLLIALKVVLSVQSRDRTKWGRIIGWLKGSATLLCLLGITWIFGFLTAVKGGTGTAFAWIFT
ILNCTQGIFIFVLHVVLNEKVRASIVRWLRTGICCLPETSSAAYNSRSFLSSRQRILNMIKVNGHSYPSTASTDDKEKQL
TPITKTTDWLSRLPNQDSVSIPESNFNNLNGTLENSNLNSAEIKEEDEIPELRRRVTVDLNPMIVSNNEIERMSHASSDP
RGSQIIEVTAVEKKAPVKRIKFPLGAKQSERGSQHRTKAKVIAPPESPVSESGSKDYRF