TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B2SKA7|B2SKA7_XANOP Uncharacterized protein OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=PXO_03968 PE=4 SV=1
MLALGLLAALPFAASAAENLSYNFVEGDYVRTPTDGRDADGWGVKASYAVAPNFHVFGEYSKQNADDNKNLFKNTNSDFQ
QWGVGVGFNHEIATSTDFVARVAYRRLDLDSPNINFDGYSVEAGLRNAFGEHFEVYALAGYEDYSKKRGIDAGNDFYGRL
GAQVKLNQNWGINGDIRMDGDGNKEWSVGPRFSW