TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B2TCH9|B2TCH9_BURPP Putative uncharacterized protein OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=Bphyt_5039 PE=4 SV=1
MASRREVERYKANLSDELHSAALYETLAKVEQDGARKQVYSELARSERDHAQVWADKLRANGLDPKGTGQAVKTRLMKGL
VRLFGAGFVLPTLAAAEYADRNKYQGQPDAGRMSADEHHHAAMVQALAHGGGDASLAPGARIAAAESWHKGAGSGNDLRA
AVLGANDGLVSNFCLIMGVAGAGTGNKAILLTGLAGLIAGACSMALGEWLSVTNARELASTQVAKEAQELEESPEAEEHE
LALIYRAKGLDAGEAKRVASQMMRDKSKALDTLTREELGLDPAELGGNPWSAAGVSFCLFSVGAIFPVMPFLWTHGYSAI
MQCVVLSMLALASIGVFTSLFNGRSAGFSALRQVVIGLIAAAFTFGVGRLLGVSVS