TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B3DUC1|B3DUC1_BIFLD Flp pilus assembly protein OS=Bifidobacterium longum (strain DJO10A) OX=205913 GN=tadC PE=4 SV=1
MSTVWVHAAAGCAAIASWLYKAPSRHDSRLPGEEPAVAHDCGSSWTILILRMLQVSLRQGSSIPRALDMVGKAVGGDCGA
RMSEVGSSLARGVPWADAWHAAMAVQHEGAPADSSSGKRTSRTQRDLGLLQSALESSWTHGDMPGVRLESAIEQLDRDER
AAIERNAAKLSVKLLMPTGLCFLPAFVLVGVIPAIASFMM