TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B3E0V5|B3E0V5_METI4 Ferritin-like domain fused to DUF125 family domain OS=Methylacidiphilum infernorum (isolate V4) GN=Minf_2378 PE=4 SV=1
MSKSDGTVDSPIKIAEYFKKNAVFLPLMPFNKNDPLVQILKKNWLNEKKTARTYRDLAEIEKNPRKKEILLKLAQTEEQH
ALRWEKELAALGQSCSEKIPRFKRILEKWLNQNLGFKNVIQRMERAEEQDKARYLQQKAQFKESAEIVQLLEELAKEEKS
HAGILHNLPRETPFTENITENILAREKWHGRGGNWITDSIYGINDGLGAVFGIVSGVAGATENQTHYILISGLAGMIASS
LSMGAGAYLAAKSQKEVYEAEISKEKREIEENPQEEIEEMALFYQLQGFNEEEAKWISEKLYQKPEHFLSAMVSSELGLS
HASFPNPWNACLSASLSTALGAFIPLIPFFFLSGIWAISLSFFISLVAHFLVGAAKTLITARSWLSSGLEMTVVGIIEAV
VTYTLGLLFRLPA