TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B3EYM9|B3EYM9_GEOSE Arabino-oligosaccharids-binding protein OS=Geobacillus stearothermophilus OX=1422 GN=abnE PE=1 SV=1
MMRTKKMKTLFLALAFAVISALVGCSDKNASVGNGNGEKIELTFMFRGQPQEQTAYKNVVKKFEEKHPNVKVNIVVTSPD
QYATKLRAAIAGRKIPDVFYFNPGELRAYVNSNVLLDITKYVENSKGVNLQDIWEKGVNKYRFDGEKVGQGNLYGLPKDL
GPFALGYNKTMFEKAGIPLPDKDKPYTWQEFIDVCKKLTKDTNGDGKLDQWGTGLNATWTLQGFVWSNGADWIDESKTKV
TVDDPKFIEALQFFADMQNKYKVTPSIAEAQTLDTYQRWLRGQLGFFPVGPWDLAAFDQQIKFEYDLIPWPAGSTGKPAT
WVGSLGIGVSSMTKHPKEAVELALYLSADPEGQKALVDQRVQLPNSVKVAEEWAKDPSIKPANKQEFLDIINDYGHSFPT
EYTYNGEWYDEFYRNLQPVLDGKMSAEEYVKKAKPKMQKLLDQAIEQEKQASKK