TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B3EYN0|B3EYN0_GEOSE Sugar abc transporter, permease protein OS=Geobacillus stearothermophilus OX=1422 GN=abnF PE=3 SV=1
MILKEGRGVKRRRSHQSSLYRKEKIYAYLFISAPVIGFLVFTFVPSIYSLYGAFTDWNGLGQMNFIGLDNFKALFKDEYF
YKAMYNTIFMMIGIPIGVVLSLLLALALNRGVPGTNVFRVIYYIPVISSIAAISILWQWAYNGDYGLVNQFLGFFGIKGP
NWLQNVHTVKPALIIMAVWKGLGYTMLLYLAALQSVPKTFYEAAKLDGANALQSFWYITLPMVKPVTFFIIVTSVIGGAQ
IFTEIDVMTPNGGPEFSSASIVWYIWQKAFGNFQLGYASAMAVILGIFIFIVTYIQFRLNERSRFDMD