TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B3EYN1|B3EYN1_GEOSE Sugar abc transporter, permease protein OS=Geobacillus stearothermophilus OX=1422 GN=abnJ PE=3 SV=1
MHFLIRRIVMEAVVQKNAKLNVNTVAKKNRIINLVLFFLLSVGAVFMIAPLLWMVSTSLKDKQDVFSLPPKWIPETIHFE
KYIEIWEKGPLLSGMINSLIVAVTVTVVGTFTSSLAAFAFAKLRFPGRNKIFLLLLTSMMIPYPVVMIPQFIMFSSLEWT
DTLLPLIVPGLFGNIMMIFFLRQYLSSIPDSIIEAAKIDGCSYFQIYYKIVLPLIRPAVAAQLILWFMGIWNDYLAPIIY
LNSPEKQTLQLVIASFNANFAIQSDYPLIMAASVVALLPMIIVFVIFQKQIIESIAISGIKG