TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B3L7M4|B3L7M4_PLAKH Putative uncharacterized protein OS=Plasmodium knowlesi (strain H) GN=PKH_113100 PE=4 SV=1
MHVYILLALLVGYVAATGVVGWRFLRIYCHKDERNNFLNITIRLVIIMGYIQCMGMIIIVPAVAQVASFPKMKEHFNPNF
MCKIIYAIFGIYVFIITPCLAVIYSHVGEVSHTDQYASEPNKRRIKHWGRYIRKICTHRTSAICKNVLLMWIVSITLSCC
ILFLTYLHFHKIRLSLNAHSCTQWYPYLEETMRKKLLSLNLKNIKMCQNVGNENIPIVFNLNFNDYVIMFVSLMGSIVLA
VYVGVGLVSLPLGLLFSAVSRYRGGEATPAIKVTNADERREDIFKDQLIRINRKAEDLLQVTQEVELSREQTCKSNYIKS
FLQNIQHKREKRILNYMVHRLVVDYEKSVYRYNNPTSVTSSYGFFLLGFFFLLANASIIVYLYLCILRGSAGQGKLTSGW
LLHWDATQELLERKDSLPLSLLIYPLVASYFLVCAFSGFNYICHKVGLLLALERKNTYLDIILLNTCLLMFVSSGAALII
LRLFPAYAKEPYAFAFFDLALKNLSIIGYLYTRNGLLHLILVVSVLTVLLFFVPEESDLFSVFMPATFRKILNQPGEADS
GIVSDIELEGQLDVNIKRKTTVDKC