TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B3WFV9|B3WFV9_CAEEL Protein F52B5.1c, partially confirmed by transcript evidence OS=Caenorhabditis elegans GN=abts-1 PE=4 SV=1
MEEETDEESPAKIARSRSCEPPGSSSRSRESRGSLWMSMGVHVENSRRRRMSKARRESQSIELSSLAPGTRVMFLLKEKE
NTPALFTEMGELNNEEWRETARWVKFEEDVEQGGNRWSKPHVATLSLHSLFQLRSCIMNGHFMNDLAETDIPSIFNAVIE
NLEKSGDLPSENREELREILLRKHVHQYEQPPFWAFSRWFDDLVTSSSPSTSRTSSFSSHSLSSSQQVFHECLSNILLTI
SIRKAKKNGAGGEKGGFLSTVRSISDIGKSFSHGKNLSKIEEKPEGPVTSQTAGAPSGSSNQLTLPTVESVPKDISSEES
SKGNLHFLKKLPAGVEASNVLIGEVDFLTRHICCFIRLKNANQLGDLTEVPVPTRFIFLLLGPTGHGQQYREIGRAIATL
MADEIFHDVAYGARDVDDLLDGIDEFLDQVTVLPPGEWDPNIRIEPPSKLPSQEKRKQIGQELLVEPSSHKHVKKVVEEE
EIHSHGDDPALKRTGKLFGGLILDIKRKAPHFVSDFTDAFNLQCLASICFMYFGLLAPIVTFGGLLEEATHQRMAAMENL
FGGALCGVIYHFFAGQPLTIVGSTGPVLVFETIVFDFCHRFGIVYLSFRFWVHVWTAVIIFLMVVTDASALVSFITRFTE
ESFATLIAVIFIYEAIMKLVKIKGQLDMINYSRDFVEGGFCSCVPPIGKPSVSPDHARLVIKSTGLPIAFNDTFIDYTAA
NLTDCRTIGGSFDGTTCFPLYDKLLMSILLTVGTFFLATTLKKMRNSCYFPSSVRQLLSDFAVMIAIASMTFVDIFVGVN
TPKLNVPSTFRPTWEGRGWFIPPFDANEWWTAPLAILPALLACILIFMDQQITTVIVNRKENKLKKGCGYHLDLLVLSVS
ILMVGFLGLPIYVAATVLSINHINSLKVESECKAPGEVAQFVGVREQRVTGIVTFLIIGLSVLATNILGRIPMPVLYGVF
LYMGISALGGIQLFDRTLLLFMPMKYQPDTIYIRHVPIRKIHLFTAFQIGCLALLWVIKSIKSTSILFPIMLVVMVAIRK
MMEKAFTTTDLKYLDDPMPDFHLRKKEDAKRRQSERVIIYLITFILQFQGEAVEIEFDNENQATIHAVKTEAHLHIPMAS
GNVIKIPLAAIQEPSHSINLTKEVNNSGMWKHITSVDSKNSLVRDVPASSDPTSSRDAPIEQPEDDDDPIMIKVIRPSPH
TSTSNLTTENTPLLKDEEPPKTNPDEPKV