TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B3XQE5|B3XQE5_LACRE Signal transduction histidine kinase, LytS OS=Lactobacillus reuteri 100-23 GN=Lreu23DRAFT_3257 PE=4 SV=1
MYLTILMAERVGLIIILAFLLVSVPLFRRLLFNQTISAKIQLTILFSIFAIMANMTGIEIGANNQLHNKIILTAISTNDS
IVNARILAVSVAGIIGGPWVGSLVGLVAGVHRIIQGAPLQGWFYVPSSVLIGALSGFLYHDRKSYFKVMTPWHGFIVGIL
MESIQMLFILLFSPTGWVLVKYIALPMILVNSLGTSIFLSIISMYLHQEEELRAMQTHSVLQLTNETLPYFRQGLNKSSA
QQVVKIIKKYTNFDAVSITDRQRILAHIGAGDDHHIPGNRLETSLSSNVIKTGQIKIANNSKMIGCIDPNCPLEAAIVAP
LRIGNEVIGTLKMYYTDQWHLTPVEIQLAIGLCEIFANQIALGEAEVQAQLVRDAKIKALQAQINPHFFFNAINTISAIL
RRDQEKARELLLQLSNYFRANLIGARETEITLGQERMQVDAYLELEQTRFPQKYNITFDQQVENDVYLPPFTIQVLVENA
LKHAFGARKDHNNVQITIKQLGARLAIQVADNGEGIAPELLPKLGKEPLTSSKGSGNALYNLNQRLIGLYDERSTLQITS
SNKGTKIKISLPYHTKEGADNESLNR