TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B5X2N0|B5X2N0_SALSA Glutamate receptor-associated protein 1 OS=Salmo salar GN=GRINA PE=2 SV=1
MSQPDRNIYSSLEGGIQPPNVGFGQPSPPGYGMTLPNTQGMPNPFGGPGPAPGGMPFPTPGAFGQPMYSQGHGNPGYGMT
LPNTQGMPNSFGGPGPAPGGMPFPTPGAFGQPMYSQGQGKPGYGTAPYAPMPGAYGQGFDNPNHEPNTDYHSDDQPPGFS
DNSSFSLGSGLDDKTIRRAFIRKVFMVLTVQLMVTFFFVALFTFVEEIKVFVRANTWTYWASYGVFFVSLITISCCGEFR
RKHPWNLIALSILTLAMSYMVGMIASFYDTDSVIMAVGITAVVCFTVVIFSLQTKYDFTSCHGVLLVCLIVLVLFGFLCI
FIRNKILELVYASLGALLFTCFLAVDTQLLLGNKENALSPEDYVFAALSLYTDIINIFLYILAIVGRARN