TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B5Y0L3|B5Y0L3_KLEP3 Uncharacterized protein OS=Klebsiella pneumoniae (strain 342) GN=KPK_4204 PE=4 SV=1
MAHKIKALAVSIGATLVFASFASHAEITLLKQDPQAGDPLSRLNFTVGGSIRPQFNMMTGDGDKGSYKRNGFDGGTRFRF
AADYYLFDDISWISYYELGVNIPALFDWDNHYAEGANNTTRRMLYTGLKSDTWGTLTYGQQNSIYYDVVGVKTDIWDYDM
IGQAPGNGINGDYDGSYRSRNMLKYKKTVGDVDLYGSYLFEDSEYLPGNGLRYKRKGGGSVGADYHIMKDLTWGTAWNYT
RAEMRDPSSADSKTYDQNIVGTALSWTPDNWTFSFGGGWYQNFLTTKKTDVHNYFAGDAWGIEYFAGYKFPINQYAVKSI
QPYFMGDRLQYVNGRNYQRIDNGLGISFQLDYGFRVDYEHVFTSSTDNLGDMNLVRLRYDF