TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B6JLI8|B6JLI8_HELP2 Outer-membrane protein of the HefABC efflux system HefA OS=Helicobacter pylori (strain P12) GN=hefA PE=4 SV=1
MNTIIRYASLWGLCAALTLAQAPSKTPDEIKQILNNYSHKNLKLIDPPTSSLEATPSFLSSPKETATTINQEIAKYHEKS
DKAALGLYELLKGATTNLSLQAQELSVKQAMKNHTIAKAMFLPTLNASYNFKNEARDTPEYKHYNTQQLQAQVTLNVFNG
FSNVNNVKEKSATYRSTVANLEYSRQSVYLQVVQQYYEYFNNLARMIALQKKLEQIKTDIKRVTKLYDKGLTTIDDLQSL
KAQGNLSEYDILDMQFALEQNRLTLEYLTNLSVKNLKKTTIDAPNLQLRERQDLVSLREQISALRYQNKQLNYYPKIDVF
DSWLFWIQKPAYATGRFGNFYPGQQNTAGVTATLNIFDDIGLSLQKQSIMLGQLANEKNLAYKKLEQEKDEQLYRKSLDI
ARAKIESSKASLDAANLSFANIKRKYDANLVDFTTYLRGLTTRFDAEVAYNLALNNYEVQKANYIFNSGHKIDDYVH