TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B6JLI9|B6JLI9_HELP2 Membrane fusion protein of the HefABC efflux system HefB OS=Helicobacter pylori (strain P12) GN=hefB PE=3 SV=1
MIQKILIGLFLSFLSMEAGERVYAIFNVKAMQDSKLTLDSTGIVDSIKVTEGSVVKKGDVLLLLYNQDKQAQSDSTEQQL
IFAKKQYQRYSKIGGAVDKNTLEGYEFTYRRLESDYAYSIAVLNKTILRAPFDGVIASKNIQVGEGVSANNTVLLRLVSH
ARKLVIEFDSKYINAVKVGDTYTYSIDGDSNQHEAKITKIYPTVDENTRKVSAEALLSKPMAVGLFGDGFIQTK