TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B6JLJ0|B6JLJ0_HELP2 Cytoplasmic pump protein of the HefABC efflux system HefC OS=Helicobacter pylori (strain P12) GN=hefC PE=3 SV=1
MYKTAINRPITTLMFALAIVFFGVMGFKKLSVALFPKIDLPTVVVTTTYPGASAEIIESKVTDKIEEAVMGIDGIKKVTS
TSSKNVSIVVIEFELEKPNEEALNDVVNKISSVRFDDSNIKKPSINKFDTDSQAIISLFVSSSSVPATTLNDYAKNTIKP
MLQKINGVGGVQLNGFRERQIRIYADPTLMNKYNLTYADLFSTLKAENVEIDGGRIVNSQRELSILINANSYSVADVEKI
QVGNHVRLGDIAKIEIGLEEDNTFASFKDKPGVILEIQKIAGANEIEIVDRVYEALKHIQAISPSYEIRPFLDTTSYIRT
SIEDVKFDLVLGAILAVLVVFAFLRNGTITLVSAISIPISIMGTFALIQWMGFSLNMLTMVALTLAIGIIIDDAIVVIEN
IHKKLEMGMSKRKASYEGVREIGFALVAISAMLLSVFVPIGNMKGIIGRFFQSFGITVALAIALSYVVVVTIIPMVSSVV
VNPRHSRFYVWSEPFFKALESRYTKLLQWVLNHKLIISIAVVLVFVGSLFVASKLGMDFMLKEDRGRFLVWLKAKPGVSI
DYMTQKSKIFQKAIEKHAEVEFTTLQVGYGTTQNPFKAKIFVQLKPLKERKKEGELGQFELMHALRKELRSLPEAKGLDT
INLSEVALIGGGGDSSPFQTFVFSHSQEAVDKSVENLRKFLLESPELKGKVESYHTSTSESQPQLQLKILRQNANKYGVS
AQTIGSVVSSAFSGTSQASVFKEDGKEYDMIIRVPDDKRVSVEDIKRLQVRNKYDKLMFLDALVEITETKSPSSISRYNR
QRSVTVLAEPNRNAGVSLGEILTQVSKNTKEWLVEGANYRFTGEADNAKESNGEFLIALATAFVLIYMILAALYESILEP
FIIMVTMPLSFSGAFFALGLVHQPLSMFSMIGLILLIGMVGKNATLLIDVANEERKKGLNIQEAILFAGKTRLRPILMTT
IAMVCGMLPLALASGDGAAMKSPIGIAMSGGLMISMVLSLLIVPVFYRLLAPIDDKIKRFYQNQKTLE