TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B6R297|B6R297_9RHOB Ferrioxamine receptor OS=Pseudovibrio sp. JE062 GN=foxA PE=3 SV=1
MGIHYKSALLSGSSISLLLLTGIAAAQEASSSNQDLDEVVVYGSTVAEDALAPTLGYVPTETASAGRIGLPIEETPRSVS
VVSSQQMEDQGAESIVDAISYSAGVVPAIYGFDLRYDNYAIRGFESAVGGLNYRDGLPLRIFAWGGWNIEPFGVERVEVL
RGPSSDLFGANQPGGLVNTVTKRPQEEFSAVLQATYGNNNRKQLAADVTGSLSEDSPISYRIVGVGRLSDTQVDDVHDDR
LYIAPSVTAKLGDKTKLTLLAQYQKDFQGESWQILPQHGTLLSNSQGSFDYDTFAGDPDRNGLERDQHYVGYELDHQFDN
GLELYQRARIAYNKITYDGAYNGGAVDFDTLLAGGAPQVSGVDTAILVKNEVEETGYQGSIDTALKYDATFGSVETQFIA
GLDYYKGYSEADLGSGYAGEKNLFTGEITNLLPTLPGVNPALLKDYTGFSDQSVTQTGLYAAANSKIFDKFRLDLNIRHD
WLDRDVKGERPEPGSSPAREQTFDRALTGRIGVSYVSDYGITPFASFGTSFDAPPAGMTKEGKAFKPTHAEQFEVGVKYA
PTNFDGFFSVAGFQITKDNVLTNDPNNTGPLPASLQAGEVRVRGIEFEGAIELYSGLSALGNYTYLDTEVTKDTTASLVG
NQLERIPEHAGSLWLKYNFAEDTWLKGLSVAAGARYLGERFGDNENAIKLDAVTLFDAALSYEYRNLKLSFTGRNLADKS
FISHCGKASLASLVPAALNVDSHNCTYGKGRELRLQLTSTF