TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B7L6N0|B7L6N0_ECO55 Putative sulfate/thiosulfate transporter subunit: ATP-binding component of ABC superfamily transporter OS=Escherichia coli (strain 55989 / EAEC) GN=ynjD PE=3 SV=1
MLCVKNVSLRLPESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAGQFSCTGELWLNEQRIDMLPTAQRQIGI
LFQDALLFDQFSVGQNLLLALPSTLKGTARRNAVKDALDRAGLAETYHQDPATLSGGQRARVALLRALLAQPKALLLDEP
FSRLDVALRDNFRQWVFSEVRELAIPVVQVTHDLQDVPADSSVLDMEQWSENYNKLR