TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B7V282|B7V282_PSEA8 Putative outer membrane protein OS=Pseudomonas aeruginosa (strain LESB58) GN=PLES_01661 PE=4 SV=1
MSRTLATVMLAGGLLAAGQAVAEDHDMTPTHETDSGPLLWHNESLTYLYGKNFKINPSIQQTFTLEHASGWTWGDLFIFF
DQINYNGKEDASNGKNTYYGEITPRLSFGKLTGADLSFGPVKDVLLAGTYEFGEGDTEAYLLGPGFDLAIPGFDYFQLNF
YYRKPDGNRVRAGAWQITPVWSYTIPVGNSDILIDGYMDWVINNKSASTSRRNQSDYHANLHFNPQVKYDLGKALGYEPK
HLYVGLEYDYWSDKYGVKDSQYFTTDQNTASFLVKYHF