TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B7V2E7|B7V2E7_PSEA8 Putative uncharacterized protein OS=Pseudomonas aeruginosa (strain LESB58) GN=PLES_02311 PE=4 SV=1
MKKMMQGAAALIALVGAGESMALEWMSNSVGFRYGQQFTNPNNPDKFAKRIYSFTHADGYRYGSNFFNLDVFLSGNRDPR
KGTDHGGSEVYAVYRHQLYASRVFDRPLGTGLVKDYAFTLGFDASRNNNLASAKKRALVFGPTLKFNGPGVLDLSLLYYR
EKNHFGVPGARHPDHTFDTTYMLNLTWMRPFKVGNHAAKFQGFVNYVGEKGEDYNDKDTAAETLVRTALMVAALPGDKRQ
PNLWLGVGYEYWHNKFGVDGGTGSRTSTPTLNMEFTF