TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B8C2G2|B8C2G2_THAPS Uncharacterized protein OS=Thalassiosira pseudonana GN=THAPSDRAFT_5273 PE=4 SV=1
MTTKRIVSTVASTPLKISTKTIDITKQATRTSATMATKLVTGLDLNGFSAAQQKEREEEEEEQRREYVQNSIGQPVYIGA
SARKQRLSSDSMNGTTAVRSSHLGVDAGVPIPENAYDEFGMNGNVTSDNEGDVDQEYDNDKSDAFAHPQDRGNPFLGWIP
WTLHLSYDRMLRGIPGTGTRDGGMGGKLLGVNLDAIVLFRFHDLCLRVTALATFVCVGIILPLNITSCTMEDPYCATLPA
NANLTNYGRTTIANVLYIASEEAQATGFFTLDKKQYQIFTKFFWADQSLPHLIRLYIISVCTWIITYYTLKNIKREWREN
LVLRRVYYLESDHYGNRQSELDKTVFLPHADDTDEEGSDDDDGVDLRRRRAINRGLTKPKYKTRQPWIPHPEHRDTIPNI
ELYSVLVGGLPSLPNEVVNSEDMQTAIGISKRASIDWQLAVATTFFDHCVPNQPGFSSSVVAVTILPGAPELAKAWRKWY
AAAAALRRLRFIRQVINSKRHYDIDDVEVDEESQPSMNATIPVDFHESQTPTLDMPQCKPKVTFLDDDTASQRFQDAETN
RQVAEYRKTYGASHNPSDIDYRIFRSLNYGPEQQAVYSREMAQGAAACCPNGCCEGRVRRQPIDRLMEMEEATIDRLENA
QYQLQCAQMQAAVSIVDKGDAKSKYQSTQDTEFMLQDAERMLSRSAHSPQRTPSKSIYVGEGITKTPSSEGVELPSLDSV
FSGDGDDSMIDVAPKTPDFFSDDLSDHSGDGTPQPKQVIPGSSDKKLAMETELLSKFGPALPSFNQSAAKLSPMRDNVPD
KSHITPETKAAALQTINEDADGSHFVSPLRNGIASPTNSAFLPPPSTRSTTLRMTSEGKFLFNSATYDDEEMSMVSGLNN
NTVAGGVVSECDVHSSAGTSLRKRALTGQSYRSEAEVSRSSNQWEQVNNILRKDDEGQQEVSQSNREIETGVWTMPSCKS
SVSSVKSFFIGSLKAVGRWTKVKTDPLTSKLAKDSTYAVVTFSSRQAAVAARHCLADGRGVHRWLSVETIPVPPLADAAP
CDIITCRGCCRPVTLNLNQNQLMLRRYIANVSLASIYVFYTIPITAAKQFVDPSSLSNTLPGFYNWLNSSKYLSADIVSG
LVSALLYTTFFALCPVMFKMIANAGSQATSVQEAEKYALHYYWYFMLVTAFVFTGLADAAIDIWYHSNVEQSLEELFENI
ASATPLTTSATWLNWIIVRTTVNTFIFGCIGWRCCARCTMGGGPGGPIPYRIYIDCGVVFVCVVALAPQSPLVAPAALLY
YIVCTPLWRRNCIFMYRPKFDSGGERWPFLSDVLITSLWMGQFLLTLQMALRDAFGPALLAALPAIPTYLYRNHLIKRFR
RAYDDAGLLQTSLLDGWDNTIPTSTEKREEFRQFLVDAHKAAYIPVCIAGGATNILTAEPAVVIPSENDDMIGYSEMATS
GRPEMPMNDIPMSPYFGDQAPVFQQASGVDVESMASPPVFNNNRGACMRRAMSFSNTPKSSAATNSNQFSEPMSPIANNN
GTESMWQKVRDEVGSSSFQNEDPGCAQS