TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B8D1W6|B8D1W6_HALOH Uncharacterized protein OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=Hore_04350 PE=4 SV=1
MSILTKEFRLLYGNKVFLLCFLFFTLIYSAIGYGARYVYEEVVNDLNVVYYFIFVYSMSLTLLMLQVYPASNDIREQAYG
GVENILATGYPLSKLILHKMLPIFSALYLPSSIMVVIIIIWSKLYLAGLVALLCILPVINAGLSLIYTCTVLLSPIPGMV
MNQISFYAVAGIFLLSYGPVLIYRTTGYVVGIKVSILLSFVFSLLVGFRAYRKFKKTDKETIIIRGDY