TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B8GZE9|B8GZE9_CAUCN Cobalt-zinc-cadmium resistance protein czcA OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=CCNA_02473 PE=4 SV=1
MKSPAPATTIREATMLERIIAASIRLRWVVLALVALSAAVGIWSFQRLPIDATPDITNIQVQINTEAPGFSPLEAEQRVT
FPVETAIAGLPGLQYTRSVSRYGLSQVTVVFKDGTDIYFARQLVGERLQSARAQLPPGVNPEMGPISTGLGEIFMYTVEA
KPGARRPDGKAWTPEDLRTLQDWVIRPQLRNTPGVTEVNTIGGFERQYHVTPLPDRLSAYGLTMGDVVTALEKNNANVGA
GYIERYGEQYLIRVPGQATGVEDLKAVIVASRNGAPIRVADIADVGLGEELRTGAATENGQEVVLGTVFMLVGENSRTVA
RATAARLEEAAKALPAGVTAEPIYDRTNLVDRAIATVEKNLVEGAILVIVVLFLLLGNIRAALITAAVIPLSMFLTITGM
VQSKVSGNLMSLGALDFGLIVDGAVIIVENCLRRLGEAQHRYGRLLSRDERFALVAGATSEVIRPSLFGVLIITLVYVPI
FALTGVEGKMFHPMAITVVIALTAALVLSLTFVPAAVALFVTGKVEEKENLIMRGARRLYEPALETALRLRVAFVAGAVL
LVAIAAFAASRMGSEFVPNLDEGDIAMHALRIPGTSLSQAIAMQTALEAKVKTLPEVDRVVSKIGTAEVATDPMPPSVAD
TFIMLKDRKDWPDPRKPRAQLVAELEAVVAKVPGNNYEFTQPIQMRFNELLSGVRADVAVKVFGDDLDQLLAIGEQIGGV
IEGVEGAQDVGVEQVTGLPVLQITPDRAALARLGLNVDDVQSVVATAIGGTVTGQVFEGDRRFDVVVRLPEAVRGRIDDI
GRLRIPLPGAIDQPRGFVPLQDVARIEMVIGPNQISREDGKRRIVVTANVRGRDLGSFITEVQRKVGAQVELPTGYWITY
GGAFEQLISAAQRLQLVVPAALLLIFGLLYALFRSVKDAAIVFSGVPLALTGGVAALLLRGMPLSISAGVGFIALSGVAV
LNGVVMVSFIRTLRQQGTDVDHAIREGALTRLRPVLMTALVASLGFVPMAFNVGAGAEVQRPLATVVIGGIISSTLLTLQ
VLPALYRLAYSQARAVR