TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B8MIR9|B8MIR9_TALSN Uncharacterized protein OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_050210 PE=4 SV=1
MSYAEAAAKGASQPPEEIQANPYSRAPIPPQVEKTESVSTASLIDVDAPSVQSVHSDFLDQEVKTTTQAERLAREAEQAA
LAQEQAAAAAAASGKKGKKSKAQGLSKNAQNPVYLGNAFIITALSAALGYSAYRKHTEGKLSWEVTGIWAGAVGLFAGAD
YFVSKWLIQNKYPKKD