TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B9SQ26|B9SQ26_RICCO Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0643760 PE=4 SV=1
MGDFNLALVIVAIVVCIVVLLFNVYLLVNYQHPDDKNQAYFPKFVVVLGLSVALISILMLPADVANRQACRHAIYNGACN
LTLPMKDLWIAVYIIDAVLVFFIIPFAMFYYEGDQDKSVGQRIKSALVWVITTAIVCGLVLGILYGLVGKVDFTVRHLSS
TTTNFPSTWEFSSGQPCIGSGARQCSAYLANASSEKTWSMRTTFPEYVVALATIVGSVLFAIFGGVGIACLPLGLIFSFI
RRPKAVITRSQYIKEATELGKKARELKKAADALHQEERSGSKGRKWRKNVKAVEKELFQLEEDVKLLEEMYPQGEKAETS
WALTVLGYLAKLVLGILGLIVSVAWVAHIVIYLLISPPLSPFLNEVFIKLDDVWGLLGTVAFAFFCFYLLLAVIAGAMML
GLRLVFITIHPMKWGGTLMNSFLFNVGLILLCSISVIQFCSTAFGYYAQATAAQEIFGHTLQSLRGIKYLYKYNVFQYAF
IVLAVVTLLLYAAFGWRRKKPTGRFQLSS