TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B9XJ69|B9XJ69_9BACT Putative uncharacterized protein OS=Pedosphaera parvula Ellin514 GN=Cflav_PD3166 PE=4 SV=1
MKRTCPTLLTSSLVLGLANQVYAQYTPPPPPQPFQGFINEYLRKDDPYMNKWDFGGAMRLRYEDHEGYGIPGRPGTPPAL
NNDFRAHGADVDNDYFLSRIRLHVGYVDEWWSAYVEGQSSLTYNDQRFAYANVPPVAGTVKKQGDGPEYDAINLHQAFAT
IGNHKEFPLSLKVGRQELSYGEERLVGAYGWNNIGRVFDAAKLRWQNEWFGADFFTGRVVIPENGRFDVSNDYDWFSGVY
ATSPMVPKNILDVYFLSRNASPQAAAAEPSPQFPQPSARDIYTIGSRLKSRPGELAGWDYSLEGAYQFGNFRDSRAGAPK
QRLDQQAYMVVLQGGYTFTNLWATPRLGLEYDFASGDSNPHDGKHETFDNLFPTNHRFYGSLDFVSLQNIHDVGAILQLK
PLPSVSVALQGNALWLADTHDSFYNVGGVARGGTTSTPGTGFGVNPDYSNFLGTELTAIVGWAPTRFAQLEGGYGHFFHG
QYISQTWSAPGFGARDADFCYVQLTMLF