TCDB is operated by the Saier Lab Bioinformatics Group
>BAG95361.1 unnamed protein product [Oryza sativa Japonica Group]
MSLEVAGAGAPQAQGKFLGILVCWVLGNGSLFAWNSMLTIEDYYSILFPTYHPTRVLTIAYQPFAFGITCILTYHEAKLN
TRKRNLIGFALFLISSFALIMLDIGTKGRGGLGPFIGVCIISALFGTADASVQGGLVGDLSFMCPEFIQSFLAGLAASGV
LTSALRLITKAAFENSQNGLRNGAILFFSITCFFELVCLLLYAYVFPKLPIVKHYRSKAAAEGSKTVASDLAAAGISNEH
SIQAEEDPKKCDRLSTKDLLIQNIDYAFDIFLIYVLTLSIFPGFLSEDTGAHSLGTWYALTLIAMYNVWDLIGRYLPLIK
CIKLTSRKGLTGAILARFLFIPAFYFTAKYGDQGYMIFLTSFLGLTNGFLTVCVLTEAPKGYKGPEQNALGNVLVVCLLG
GIFSGVVLDWLWLIGKGW