TCDB is operated by the Saier Lab Bioinformatics Group
>BAS22117.1 Na,K-ATPase alpha-subunit [Bombyx mori]
MGETSRKPPAKKRKPGDLEDLKQELDIDYHKVTPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCK
NLFGGFALLLWIGAILCFIAYGIQASTVEEPADDNLYLGIVLAAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIRE
GEKLTLRAEDLVLGDIVEVKFGDRIPADIRIIEARGFKVDNSSLTGESEPQSRGAEFTNENPLETKNLAFFSTNAVEGTA
KGIVICCGDNTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPE
GLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRT
SPGFKALAKIASLCNRAEFKGGQDGVPILKKEVAGDASEAALLKCMELALGDVLSIRKRNKKVCEIPFNSTNKYQVSIHE
SDDPSDPRHLLVMKGAPERILERCSTIFIGGKEKVLDEEMKEAFNNAYLELGGLGERVLGFCDLQLPSDKYPIGYKFNTD
DPNFPLDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAARLNIPVSE
VNPREAKAAVVHGTELRELNSDQLDEILKFHTEIVFARTSPQQKLIIVEGCQRLGAIVAVTGDGVNDSPALKKADIGVAM
GIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGT
DMVPAISLAYEAPESDIMKRQPRDPYRDNLVNRRLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPMKLFGIRKQWDSKA
INDLTDSYGQEWTYRDRKALEFTCHTAFFVSIVVVQWADLIICKTRRNSIIHQGMRNWALNFGLIFETALAAFLSYTPGM
DKGLRMYPLKFVWWLPAIPFMLSIFIYDEIRRFYLRRNPGGWLEQETYY