TCDB is operated by the Saier Lab Bioinformatics Group
>BAS22118.1 Na,K-ATPase beta-subunit [Bombyx mori]
MTVKKRTSDLTSLERFNMYYREKEPPLTRSQKVKRFIWNPKTRQFCGRTGSSWSKIALFYFIFYSALAILVAICMWTFLQ
LLDARQPKWQLERSIIGTNPGLGFRPTPPEVASSVIWYKGNDPGSQQFWVKKLSTFLAAYKRDGKKAGAGQNIHNCDFKL
PPPAGKVCDVDISAWGPCVQDNYFGYHKSTPCIFLKLNKIYGWRPKFYNSSDNLPKDMPEDLKEHIRNMTAYDKNYLNMV
WVSCQGENPADRENIGPIQYLPHRGFPGYYFPYTNQEGYLSPLVAVHLQRPKTGMLINIECRAWANNIKYERLEAMGSVH
IEMLIE