TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C0H4V6|C0H4V6_PLAF7 14-3-3 protein OS=Plasmodium falciparum (isolate 3D7) GN=PF3D7_0818200 PE=3 SV=1
MATSEELKQLRCDCTYRSKLAEQAERYDEMADAMRTLVEQCVNNDKDELTVEERNLLSVAYKNAVGARRASWRIISSVEQ
KEMSKANVHNKNVAATYRKKVEEELNNICQDILNLLTKKLIPNTSESESKVFYYKMKGDYYRYISEFSCDEGKKEASNCA
QEAYQKATDIAENELPSTHPIRLGLALNYSVFFYEILNQPHQACEMAKRAFDDAITEFDNVSEDSYKDSTLIMQLLRDNL
TLWTSDLQGDQTEEKSKDEGLE