TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C0P3K9|C0P3K9_MAIZE Uncharacterized protein OS=Zea mays PE=2 SV=1
MKVGGLLTSAGINIGLCVLFLSLYSILRKQPQNVKVYFGRRIAEEHNRLRDAFILERFVPSPSWIVKSLRCTEEEILATA
GLDAVVFNRILVFSIRIFSLAAILCVFGVLPLNYFGQDMHHVRIPSASLETFTIGNVEERSRWLWVHCVVLYIISAVACI
LLYLEYKHIARLRLYHISRATSNPSHFTILVRGIPKSSTESFSRTVESFFTKYHASSYLSHQVVYKVGKVQKIVSGAKKV
YRKFRHFKGATVDRRCRPIRFQCCFCGASSNSFQLLPSDYEQESEKSDVNESSSSLPDEECGAAFVFFKTRYAALVVAKI
LQTSNPMRWVTTLAPEPDDIYWSNLWLPYKQLWIRHIVTLMCSIVFMVVFLIPVTFIQGLTQLEQLQQRLPFLRGILKKK
YMTQLITGYLPSVILQIFLYTVPPTMMFFSTLEGPISHSERKKSACCKVLYFTIWNVFFVNVLSGSAISQLNALSSPKDI
PMQLAKAVPVQATFFTTYVLTSGWASLSSELMQLFGLTWNFLRRYLLRIKEDSDFLYSFPYHTEMPKVLLFGLLGFTCSV
LAPLILPFLLLYFFLGYVVYRNQYCRKRHLPLFKTFPAQNLIDMDKEDQQSDTTEDLHERLHSAYFQFPDTDEVPLERVR
VSVGRDEDGSGSSGESSRKESAEDEHKSGLSHPTLDGLPVSRLRNAVRSLGSVLRPQRRQLPV