TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C1A6K8|C1A6K8_GEMAT Putative ABC transporter ATP-binding protein OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=GAU_0826 PE=3 SV=1
MIEITSLSKRYGSFTAVRSLDLVVPAGELFGFLGPNGAGKTTTMRMIAGILQPTAGIIRIAGHDLRDAPLAAKRALGFIP
DRPFIYEKLTGMEFLRFSAGLYGQEGPEVDRRGEELLALFDLEPWRDELVESYSHGMRQKLIIASAFVHRPKVIVVDEPM
VGLDPKSSKILKDLFREYTRRGHTVMMSTHTLEVAEGMCDRIGIMQRGELVACGTMHDLQQASGNDDALEDIFLRLTGDG
AARDLMEVLDA