TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C1CEX9|C1CEX9_STRZJ Membrane protein, putative OS=Streptococcus pneumoniae (strain JJA) GN=SPJ_1290 PE=4 SV=1
MTIHIIITMLLLLAFLIGSIWFAKKKYQINLAVLGLGAVAFFVSSQILEKLVHILILHPQKDGSIALLQDHPLIYIIYGL
AMAAFFEETARLVFFKWLEKKRSLEKADALAYGLGHGGLELIFLGLISLLNLYIVLSAVQTQNPQVMQLLSENMLKTIQS
LSVWQIYLLGFERILALGFQLLLTVWVYQAVRQKKWIYLLAAYGLHAFFDLAPSLFQVGWLTNPVLVEVILALELVLVAY
GTKEIFCKKS