TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C1D8E7|C1D8E7_LARHH Putative uncharacterized protein OS=Laribacter hongkongensis (strain HLHK9) GN=LHK_01753 PE=4 SV=1
MAFPRETAMEAIKAAPPVSVTAAVLSGVSVADVIQWLTVLYLILQVAYLLAKWRRESRTAERQACVHDK