TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C1DWZ6|C1DWZ6_SULAA Putative uncharacterized protein OS=Sulfurihydrogenibium azorense (strain Az-Fu1 / DSM 15241 / OCM 825) GN=SULAZ_1675 PE=4 SV=1
MRKVKSLMAAGLLTVAAAGIYNDAKAEIQTFIGELKPELEIRPRFDWTSKNATSGAIEDATALTTRIRLGAHIDKIFNIP
LLKAYLELNDVSDLIDKKRTYGETNQYAFIADPSITRLTEAKVSYTWGKTTLLFGRTRVNLDDQRFISDANWRQTPQTFG
VLALHTKEIPNLDLLMAMIYERKWWARNDLVGTMNNKKFVDFTRTSSLDWSPDKAPLVALHIKGGLFY