TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C3N8F9|C3N8F9_SULIY Amino acid transporter, putative OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=YG5714_0105 PE=4 SV=1
MERKQVFVRETSGLIKQVSLTDAVMLNLANMSIGIALFQSISPYITQGGVLWIASLIGMFLALPQALVYTIFNRKVGRTG
GDYVWISRNLGGIIGTIFAVAYLLESTAFYAIISFFSASSINSALLTIGYLNHQNTLIYVAENVIVNPYATPTLQQRLIF
YGISALAFVIIVLINILHSKWGYKLVTSLGTFSILTVILAMIIIAINAKHFDSSVIPLLKDFNVTVSSNLPKTILPYSIS
LPATLSLLPLFSLYTYPWMNAGPAVSSEFRGDKVSKFNVFFSLLITGILVTLGFLEMDVVGGYYFNLNAYPSAIYNFWTV
AMALSLNPIIEWILGLGLILWNYFVLSYGVLVFSRYVFALSFDRVFPEKLSQLNAHGSPVYAHLLDITLTLLFLLIPVFS
IDAAISLYGASIVGMLYFLAVGISAIIFGQKTKSRLMKIAGILTTIYFVYLTYEAATNPLFGFSTTSGVNIITLSFVLGS
FVSGIIIWSVTKYMNSKKGIDLSLTFKEIPPE