TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C4LTW0|C4LTW0_ENTHI N-system amino acid transporter 1, putative OS=Entamoeba histolytica OX=5759 GN=EHI_050900 PE=4 SV=1
MSTHNNEIEMITQDTNVSNNETSQNKNENSNNDVQQHPSVTMTVLTSSTPQIEPNNEIIRSPVKTPESNLPVNETSALKS
DKKLSNNNAIEDTVAKNFEELLYEEKEYHRTASGQSKRTKKTWGKIGVTSLQLGFSLVGSLIGSGILSLAQTCYKMGIVG
YTIWIILTIIYFCLTWTYFNKAIYLTGASTLGELLSLIFGNFFAIIVDICNTLFFICVLMCDQVIATQYIFGIVQETTSR
DQWNNTLDQCYGNPQRTAGIACGWHYIILYLVAVCLNLPLIIPKSVKFLSKISVLTLVAAIITTASIIVKLIYAAATGKS
SNGSDANFPTFDGKWWPQSFMSFFTMAPFISANFQVHSCLPPLYVGTRGLSKKNKLVALQGGSYFSIITCSLFYLLIAVC
GDLSFDKVSSNVLNDFANSGRSEIDWVILICRALMTVVVCIAYPVIMFPTCAGILRYIPKQWKFMTIWNGRLSVLVIRIC
LLCLTTLAASFITNIGVIFSIGAAIFSIFVVYIGPMSIMMLWPRMEKLGDPNFRKLSVIENVLYNRKVEGNQMFTYRDIE
TAFAENEAQKNEGIADVVVTINTNETTGQQVIELNDVKEQKERPTNQNSYQLAVTMDGDSGNEDLSYLQKQWIKLPDAHI
PWYRYLLFTIAMACCVVLCILSIVGTIIETATSS