TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C4M325|C4M325_ENTHI Hypothetical membrane-spanning protein OS=Entamoeba histolytica OX=5759 GN=EHI_025380 PE=4 SV=1
MNVSNKDIYLKSKLVKDQDNSFAGFVLLPSEYSFNDICILTKNGQLSDISSKGYVFFQLKTQSTYINVKKGTYRLVYFSC
GNKKIKWVNAKIIQGYTKDGIYHYLSSGEYPMIMITEIFGFILLVVILYDLYLLYKRETHTVQTLITGFSIIIFLHLCFD
VLTLKATDSKGISNIRYFDYTFRIIETLSFYIVTLLVASGWSRKSKFSFEQKKTLLFFILLQVLSNVLYLVAEENELVNT
RVTSVLRLIDIICSICILFPLIKTLNLLKKNTGTEAKTLKQYQRFSRCYSILLTIAYVKILLAYINDIASTREFDFIYLS
VDKSLYIIYSIYLMIAFRPKKIISSSDEPKELMTENTFDETKQEISKNTKNYQPEVSLNSFPTETSQNEEIKSVVLLDNN
EHQEDTLSTTHNKNDICVELE