TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C5IZH1|C5IZH1_KLEPN RND family multidrug efflux permease protein OqxB OS=Klebsiella pneumoniae GN=oqxB PE=4 SV=1
MDFSRFFIDRPIFAAVLSILIFITGLIAIPLLPVSEYPDVVPPSVQVRAEYPGANPKVIAETVATPLEEAINGVENMMYM
KSVAGSDGVLVTTVTFRPGTDPDQAQVQVQNRVAQAEARLPEDVRRLGITTQKQSPTLTLVVHLFSPGGKYDSLYMRNYA
TLKVKDELARLPGVGQIQIFGSGEYAMRVWLDPNKVAARGLTASDVVTAMQEQNVQVSAGQLGAEPLPQESDFLISINAQ
GRLHTEEEFGNIILKTAQDGSLVRLRDVARIEMGSGSYALRSQLNNKDAVGIGIFQSPGANAIDLSNAVRAKMAELATRF
PEDMQWAAPYDPTVFVRDSIRAVVQTLLEAVVLVVLVVILFLQTWRASIIPLIAVPVSVVGTFSILYLLGFSLNTLSLFG
LVLAIGIVVDDAIVVVENVERNIEEGLAPLAAAHQAMREVSGPIIAIALVLCAVFVPMAFLSGVTGQFYKQFAVTIAIST
VISAINSLTLSPALAALLLKPHGAKKDLPTRLIDRLFGWIFRPFNRFFLRSSNGYQGLVSKTLGRRGAVFAVYLLLLCAA
GVMFKVVPGGFIPTQDKLYLIGGVKMPEGSSLARTDAVIRKMSEIGMNTEGVDYAVAFPGLNALQFTNTPNTGTVFFGLK
PFDQRKHTAAEINAEINAKIAQIQQGFGFSILPPPILGLGQGSGYSLYIQDRGGLGYGALQSAVNAMSGAIMQTPGMHFP
ISTYQANVPQLDVQVDRDKAKAQGVSLTELFGTLQTYLGSSYVNDFNQFGRTWRVMAQADGPFRESVEDIANLRTRNNQG
EMVPIGSMVNISTTYGPDPVIRYNGYPAADLIGDADPRVLSSSQAMTHLEELSKQILPNGMNIEWTDLSFQQATQGNTAL
IVFPVAVLLAFLVLAALYESWTLPLAVILIVPMTMLSALFGVWLTGGDNNVFVQVGLVVLMGLACKNAILIVEFARELEI
QGKGIMEAALEACRLRLRPIVMTSIAFIAGTIPLILGHGAGAEVRGVTGITVFSGMLGVTLFGLFLTPVFYVTLRKLVTR
RKPVQEDLPA