TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C7P4Y1|C7P4Y1_HALMD Uncharacterized protein OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=Hmuk_3277 PE=4 SV=1
MRGLDPVAAGVRILHLTAFAVWVGGAVWNIFVAVPTGQKRPTIGVVRAAGQQLERFRWAVRFIVPTLLVTGLFQAVDSLG
TAVTSYLGSGVGVAVLAKVGCIGLLVVMFKLCPMWRACSPIEGVCELDGLGESDPGENEPTDDEPHTEVTSDV