TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C8P5J1|C8P5J1_9LACO Uncharacterized protein OS=Lactobacillus antri DSM 16041 OX=525309 GN=HMPREF0494_0585 PE=4 SV=1
MGCLKKRTAKRPLILAPQLPLAWTVCWLVMATVGRALGRPLATGSDVQESVLLLSAAVMVANIYNLVILYQRPDENHRQV
DWLVISYALVLICSTVLAWGQPRLILLPQTLAGWPLVFLLLNASQAGLGIYFWQSWPRRQCHGEESCLPLWQVPVALGIT
ALLLAALIQPGGGRRVVVLASGVGLVFLLVCQWRNRDRLFAMVPARLSAGYQVLLGGQLAALLFSLVLGGSTLVQRWNGE
PMNLIGACFAISVLVVELTAGGLAAMQRYQLQYQYGLARTHRLRYRCLGALLVAGLLIGYCLA