TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C9QGR6|C9QGR6_VIBOR Uncharacterized protein OS=Vibrio orientalis CIP 102891 = ATCC 33934 GN=VIA_000934 PE=4 SV=1
MKKLAVSTAVLAAMAASPVFASGLSVDVYGDRAFAGDKKGNSTQGVEVGYDFENGLSLSAEATTNKDLDLDAAWKFQLTE
SVYLQPSVGYVLNDSKTYRAEDPNVDGGYEFLELKGTNSDVAKAGLEFGYDNSQFFYTLRGRYEANTSKLALTHETGGYD
AKGNPVNVERHSIGARSEIARFDSLIGYRFDYVTLTAKGIRKFELNKDIKRLNREMNTDNDRWSGEFKATVTAWDGVAPY
VEYTHDKAFTQHGKDDQIIKIGTKFTF