TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C9S7Y7|C9S7Y7_VERA1 DUF895 domain membrane protein OS=Verticillium albo-atrum (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_01386 PE=4 SV=1
MSDSQELRQDQVAPPKEQQHPVRWHRSTFYNMTILGLCNFAAPGIWGAMNSLGAGGAASPKLVNAANALTFCLMVVSCYF
SSVIVHYIGIKGALIFGTVGYAPFAAGLYTNNRYGTEWLMLVGAAVCGISAGVFWMAEAAIAIAYPEPWNRGKALGYWLT
YRLGGQILGGAINLGLNADRDQAGSVSYTVFIIFIAIQAAGPFVGFFLNKPSKVERRDGKKVNLSIVENPWYEIKATTKN
FMKPKFLLLLLWIGQAVFAEAVYFTYIALWFSVRARALGSFLSGIVAVISGNLLGHWLDRTKIPLKTRSRGAFWFIVITQ
GAWWTWATVMATRFRESRPTYDWSSPGFGAAFGVYIFLTIGFQINYLFLLWALAIGPAWLVLKHFGNGAEKGIHHEAQIT
QAGDGAVSSETQSEDGEGKKTFLQGCQGDWGSEPESWSWRIVGEPASPPC