TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C9U574|C9U574_BRUAO Predicted protein (Fragment) OS=Brucella abortus bv. 6 str. 870 GN=BAAG_02994 PE=4 SV=1
PTGLFLGDTSSFPVHYESNRAVLRTIIGAGLGGYSDVNAWFGRPDLFNGRNPLAGKLPGRSNTWNEGYLELGVGGAAQLG
ESNLYGFGAVTGMFSWTLGQDIFRDDDRGFLDFEKAYAGVLYVSPENRKNHFKFSAGRQAYTLNDGFLVNAVRGSTSAGE
RGGLYLGPRLTNDFSVLAQGAYDRWNYSAFFIDPNEVESLESDTTFLGANLRYNFTDKFSADTTLITIPNSKTQFSTPSG
RLIPREGLNTVSGHLKWTSAFEMPGLWLEGELAHQFHPGEDVSAWAYYGTVGYLMKEIGWTPSLSYRYAYFSGDDPNSSR
YERFDPLLSTGLGIWLQSVSFGKITTNSNLETHRVQFNVAPDERLNLTFDYYLLRTPQLNNLGSNPALSTLSSHDLGQEL
SLSARWSATKSLYLQALVSHAIPGAALRDIGADRNWTTFQVSLYGGF