TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C9XJW9|C9XJW9_CLODC Putative ABC transporter, permease protein OS=Clostridium difficile (strain CD196) GN=CD196_1968 PE=4 SV=1
MSNLSILIKTNIINEFKLNALKKADSREKQKIMGMILSVVIITGLLIFYVTSISLSLVDILKQINQMEMLLIFGFGLSTL
TTIVTSLYKTSSYLFQAKDLDLLTSLPIKESTVLASKILMLVGANYLFSSICMIIPAVVYFFNSDVSITYFPYLILLFLA
LPLLPIVASSIIFMFIGQISSRIKYKNLILIIGSIILMLLYTLLMTRLNSMSVEMLKNSVSISETIRKIYPPIYYFVDAL
KTGSVVSFLAFIAISIIPFFMFVTLFAKKFKDINAKMSEGYKSKTYKFKSQKTSRPSKALLKKEFKRYTSSFIYFLNSSA
GLLFLIIGTILILLFGADKVGELLKLNIDFNFIKIQLLGVFFFIIVMNCTTYCSISLEGKNLWILKSSPIDEREIFWSKI
LMNFLLNAPLSILCLILVSIRLGFEIQFIIVSICLIASFSMFVALMGLLSNLLYPNLDWKNEMAVVKRSASMIITMLVSL
AYVIILGGIYVLLGISFLNIYIILASILTFILDFMIWRIISTKGVRIFKNL