TCDB is operated by the Saier Lab Bioinformatics Group
>CAJ79125.1 outer membrane efflux protein [Francisella tularensis subsp. holarctica LVS]
MIRNKILPLALISATLITSSCSFFNPEYERPKIKAPALWNNQDKNIEVTKNWDLTKVAWWREFNDPVLNNLITTALKDNN
KLQVSIGNILQANAEINKANYGWLPTASVGGGGFVAQAFDVNSNSNIPQLNNIGTQTTAGSLVGIIPSYTINIARQFKLG
EISRLSKKMQTNLKDTTRLSIISQVSAAYFSLITAKEQLKLQTLMVNQLNLMFKYAQNQHKLGATSPMLEEVIRQQLEVQ
KGKIAMIKNDIVHFQNTLKILMGRNPGKIVTSRTLNEINANIKVPINMPSQVLENRPDIGIAEYKLETANANIGLARSQF
FPSIDLTGTFGNATLALGELATMNAWAWAAEAVAAVPVFNLSILADSDKAKAQFYQAYYDYINTLQQAFQDVDDSLSERA
ANAKNLKKQTISLESTQRQEKIFFKKYSSGAISKAQYTGITLNVLYQQMQVNQTKLKSLISVVNLYQALGSGYNVDNYVD
PHYDNPAFDK