TCDB is operated by the Saier Lab Bioinformatics Group
>CDP07574.1 unnamed protein product [Coffea canephora]
MKPLKLSYCSVGQKPCVRWVEKYFKDCLCNLKDEISFAFGIASLVCWAVAEIPQIITNFKSKSADGVSLAFISTWIVGDV
FNLVGCILEPATLPTQFYTAVLYAATTLVLALQCIYYDHIIRLWKGRKTKVNKDYNERSALKQNLHDRSSRDRRNAPIEV
PRPRWRDFHFRSARSLAGSDTPPIQSYIKPKSGPPALEHQSESSSEDEEAIPPEFYQRPVSQPRLIPGPVGYGTFLAVSA
YIPRGSKASQLYFVGRRLLEEKYELHGRAYGQWLGWLMAAIYMGGRIPQIWLNIKRGSVEGLNPLMFLFALIANAAYVGS
ILVRSSEWEKIQPNMPWLLDAVVCVALDLFIILQYIFYRFIKRKKSQRSEEHYEDCGTKLQT