TCDB is operated by the Saier Lab Bioinformatics Group
>CDS25233.1 ABC transporter G family protein 4, partial [Anopheles stephensi]
MSTWETIANESWAVVDNLDGMPPVAGRSSTDVTLMWQNLTITPVRSTPSSGGGGQLPVLNDISGTLQPGTLVALMGPSGA
GKTTLMSALAYRMSDKMTITGDIRVNGCPIGPFMYNISGYIYQDELLPDSITVQEHLQLMAHLKLGKRVSADRKRTMIAD
ILSKTGLERCANTKIANASGIGKTLSGGEKKRLAFAVELLSKPKFLFCDEPTTGLDSYSARQLVEMMKSLTRAGTTVLCS
IHQPAEKLLYEFDSLILLTGGQTGFIGSPHEAVQFFRLQGLECEHGYNTADFLIKVLSSTTTAKTTKGNQFTTGAICPKT
ICNNYIASEAARRQEALISAELYSTAVDGRDEAFRKQLTKARDRCWFYTLYWLMYRHVLQAHRNPNLQYFKIAQRIAIAV
LVGLCFSDAIELSQRGVQAMQGVIFLIVSENTFLPMYAALSMFPDSFPLFQREKKANLYSTAQFYISSILSMSPFVLLET
CAFILIVYFLANLRPTLLGLIVTVAVSVLVMNVSIACGCFFSTLFPTVASAMSYLVPFDYILMITSGIF