TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D0ZLR5|D0ZLR5_SALT1 Putative phosphotransferase system enzyme IIC OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=STM14_4546 PE=4 SV=1
MDTLLFASLMGLYYWFARLRLGYTFSAMLLQPVVIAVFVGLLLGNMQTAMIIGAGMQLVYLGVTSTPGGNVPSDPALAAC
ISIPIAVKAGMDPNLAIALAIPFGVIGVFLDQLRRTLNAAWVHMADKHAETANMAGIMRCAFLYPALLGLVLRFPVVFAA
NYFGQDVVESFLKLMPHWLTHSFEIMGGILPALGFAITIMVIGKKSLLPWFIGGFFAVLYLKVDIMAMAIFGTCVAFLIK
GLAKNEGAA