TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D1GQ18|D1GQ18_STAA0 Teichoic acid ABC transporter permease protein OS=Staphylococcus aureus (strain TW20 / 0582) GN=tagG PE=4 SV=1
MSAIGTVFKEHVKNFYLIQRLAQFQVKIINHSNYLGVAWELINPVMQIMVYWMVFGLGIRSNAPIHGVPFVYWLLVGISM
WFFINQGILEGTKAITQKFNQVSKMNFPLSIIPTYIVTSRFYGHLGLLLLVIIACMFTGIYPSIHIIQLLIYVPFCFFLT
ASVTLLTSTLGVLVRDTQMLMQAILRILFYFSPILWLPKNHGISGLIHEMMKYNPVYFIAESYRAAILYHEWYFMDHWKL
MLYNFGIVAIFFAIGAYLHMKYRDQFADFL